PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G009400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 366aa    MW: 39242.1 Da    PI: 6.5055
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G009400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.22.7e-5271361128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+ +yL++++++ ++++  +i++vdiyk++PwdLp ++  +e+ewyfFs+rd+ky++g r+nra+ sgyWkatg+dk+
  Brast06G009400.1.p   7 LPPGFRFHPTDEELILHYLRNRAASAPCPV-PIIADVDIYKFDPWDLPCQAVYGEHEWYFFSPRDRKYPNGIRPNRAAGSGYWKATGTDKP 96 
                         79****************************.88***************65556799*********************************** PP

                 NAM  92 vlsk...kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++    +ge vg+kk Lvfykgr pkg+kt+W+mheyrl
  Brast06G009400.1.p  97 IHDPasmGGEPVGVKKALVFYKGRPPKGSKTSWIMHEYRL 136
                         **998889999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-635179IPR003441NAC domain
PROSITE profilePS5100559.7657179IPR003441NAC domain
PfamPF023657.1E-278136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MSTAAALPPG FRFHPTDEEL ILHYLRNRAA SAPCPVPIIA DVDIYKFDPW DLPCQAVYGE  60
HEWYFFSPRD RKYPNGIRPN RAAGSGYWKA TGTDKPIHDP ASMGGEPVGV KKALVFYKGR  120
PPKGSKTSWI MHEYRLSAAD PLSSSVNTNP GAANAYKPIK FCNVSMRLDD WVLCRIYKKS  180
GLQASPMVPP LADYDHMDLH AHSSGNNNND DDGLSSFSFS GSGGGFVVDA HDAACSSFLY  240
AAPPPSSRTA MAPRLPAIPS MSELLDDYAL AQLFDAAAPD EHLAVHPSLN QLLSVGDAEY  300
YSSSSPSPAG KRKQAAAEDQ RAPAAKRMPC FAVDDAAPQS SAAESGLQAA VLGAGLSSHQ  360
MLPQF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-68318016169NAC domain-containing protein 19
3swm_B2e-68318016169NAC domain-containing protein 19
3swm_C2e-68318016169NAC domain-containing protein 19
3swm_D2e-68318016169NAC domain-containing protein 19
3swp_A2e-68318016169NAC domain-containing protein 19
3swp_B2e-68318016169NAC domain-containing protein 19
3swp_C2e-68318016169NAC domain-containing protein 19
3swp_D2e-68318016169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559782.10.0PREDICTED: NAC domain-containing protein 18-like
TrEMBLI1GR230.0I1GR23_BRADI; Uncharacterized protein
STRINGBRADI1G17480.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123736123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.12e-83NAC domain containing protein 47